Protein Structure Studio

Protein Structure Discovery Studio

Advanced tools and methodologies for predicting, analyzing, and visualizing protein structures with unprecedented accuracy and speed.

Select Protein:
PDB ID: 1cbs
0%

Cellular Retinoic Acid-Binding Protein

Rotate: Click + Drag | Zoom: Scroll

Zoom Level

Key Features

Comprehensive Protein Analysis

Our platform offers a comprehensive suite of tools for protein structure discovery and analysis

Sequence Analysis
From sequence to structure prediction with multiple sequence alignment, secondary structure prediction, domain identification, and evolutionary conservation analysis.
Structure Prediction
AI-powered tertiary structure prediction, template-based modeling with refinement, ab initio modeling for novel proteins, and quality assessment.
Structure Analysis
Binding site prediction, protein-protein interaction interface mapping, structural comparison, and electrostatic surface analysis.

AI-Powered Protein Analysis

Leverage state-of-the-art machine learning models for structure prediction and analysis

AI-Powered Structure Prediction

Our platform integrates multiple state-of-the-art AI models for accurate protein structure prediction:

  • AlphaFold Integration
  • RoseTTAFold
  • ESMFold
  • Custom Models
AI Protein Structure Prediction
Our Workflow

From Sequence to Structure

Our platform guides you through every step of the protein structure discovery process

1

Sequence Input & Analysis

Start with a protein sequence or identifier. Our platform automatically retrieves and analyzes the sequence, providing insights into its composition, domains, and evolutionary conservation.

>Protein_XYZ
MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG
2

Structure Prediction

Our AI-powered prediction engine generates accurate 3D models of your protein. Choose from multiple prediction methods or combine them for ensemble predictions.

AlphaFold Integration
RoseTTAFold
ESMFold
Custom Models
3

Model Refinement

Refine your predicted structures with molecular dynamics simulations and energy minimization. Validate models against experimental data and structural quality metrics.

Energy Minimization
Loop Refinement
Side Chain Optimization
4

Analysis & Visualization

Explore your protein structures with our interactive 3D viewer. Analyze binding sites, electrostatic surfaces, and structural motifs. Compare with similar structures from databases.

Export Results
Share Visualization
Applications & Use Cases

Powering Research & Development

Our protein structure discovery platform supports a wide range of research and development applications

Drug Discovery & Development
Accelerate your drug discovery pipeline with accurate protein structure models
  • Target identification and validation
  • Binding site analysis and druggability assessment
  • Structure-based virtual screening
  • Lead optimization with structural insights
Enzyme Design & Engineering
Design novel enzymes or engineer existing ones for improved catalytic efficiency
  • Active site analysis and redesign
  • Substrate specificity engineering
  • Stability enhancement through structural modifications
  • De novo enzyme design for novel reactions
Antibody Engineering
Design and optimize antibodies for therapeutic applications
  • CDR modeling and optimization
  • Antibody-antigen complex prediction
  • Affinity maturation guidance
  • Developability assessment and optimization
Basic Research & Education
Support fundamental research in structural biology and protein science
  • Structure-function relationship studies
  • Evolutionary analysis through structural comparison
  • Teaching tools for structural biology concepts
  • Hypothesis generation and testing

Ready to Discover?

Start your protein structure analysis journey today with our comprehensive platform.